Evexia Aminos

Research Access Only

All products sold by Evexia Aminos are intended

FOR LABORATORY AND RESEARCH PURPOSES ONLY.

Products for sale on evexiaaminos.com are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

By proceeding, you acknowledge, confirm, and understand the intended research-only nature of these products.

By entering you accept our Terms & Conditions and Privacy Policy.

Lot: —
Grade: —
Purity: —
Vial Size: —
Tested pH: —
⚠ Research Use Only

This product is intended strictly for in-vitro testing and laboratory research purposes only. It is not for human, animal use, or consumption of any kind.

These products are not drugs, foods, cosmetics, or dietary supplements, and have not been evaluated by the FDA. Purchase and handling are restricted to qualified or licensed research professionals aged 21 years or older.

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH), consisting of the full 44-amino acid sequence of endogenous GHRH with a trans-3-hexenoic acid modification at the N-terminus. It is supplied as a lyophilized powder in a research-grade vial for in-vitro laboratory use.

Evexia Aminos supplies Tesamorelin at >99% purity as confirmed by HPLC analysis, with full-panel third-party testing including identity, net content, endotoxins, heavy metals, microbials, and sequence verification. A certificate of analysis is available for every lot in our COA Library.

Molecular formula: C₂₂₃H₃₇₀N₇₂O₆₉S · Molecular weight: 5196 g/mol · CAS: 901758-09-6

This product is intended strictly for in-vitro laboratory and research purposes only. It is not intended for human or animal use, consumption, or any therapeutic application.

  • Tesamorelin 5mg
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • Molecular Weight: 5196 g/mol
  • PubChem CID: 44147413
  • CAS Number: 901758-09-6
  • PubChem Reference: View on PubChem →
  • Store at -20°C (freezer) for long-term stability.
  • Keep away from light, moisture, and heat.
  • Once reconstituted store at 2–8°C (refrigerator).
  • Discard any solution that becomes discolored or shows signs of contamination.

This product is supplied as a lyophilized powder and is intended strictly for research use only. Researchers are solely responsible for the appropriate reconstitution of all Evexia Aminos compounds. Reconstitution Solution is sold separately. We do not sell syringes, nor do we provide instructions on mixing, dosing, or any research protocols.
This product is limited to in vitro testing and laboratory experimentation and is not intended for human or animal use or consumption under any circumstances. Handling and use are restricted to qualified or licensed professionals only.
This product is not FDA approved and is not classified as a drug, food, or cosmetic. It may not be represented, marketed, or used as such.

All orders placed through Evexia Aminos are shipped via UPS (free 2-day shipping on orders over $150), and includes full insurance in the event your package is lost, stolen, or damaged in transit. Once your order is handed off to UPS, delivery times are no longer within our control. While most shipments arrive within 2–5 business days, delays may occur due to weather conditions, holidays, high-volume periods, or weekend inactivity, during which packages are not in transit. To help ensure product integrity during transit, all research materials are packaged in protective boxes that shield vials from direct sunlight and temperature fluctuations. Additionally, our lyophilized (freeze-dried) research peptides are highly stable and can withstand elevated temperatures for extended periods of time without compromising quality or efficacy. Because of this, we do not ship with cold packs.